3 hours per seq on a Duron 650

[Medic193]

Title says it all. Kind of weird. Nothing else is taking up resources, a reinstall og the client or reboot do not change the situation. I'm reinstalling the OS right now. That should fix the problem. It took me a week to notice this though. That sucks.

[Dustin]

You just need to OC it more.:p

[Yo_Mama]

My D650 does a 78aa sequence in 17-19 minutes.

[Medic193]

Software screwing up. Reinstalled the OS and it works fine now.

[MikeTimbers]

Originally posted by Yo_Mama
My D650 does a 78aa sequence in 17-19 minutes.

??? My D900 takes 19 minutes to do a 68 ??? WTF, over?

[Yo_Mama]

My bad - it's a 72

20010827 043138: Designing protein sequence 11 of 30
20010827 043417: 10.0 %
20010827 043638: 20.0 %
20010827 043852: 30.0 %
20010827 044057: 40.0 %
20010827 044255: 50.0 %
20010827 044452: 60.0 %
20010827 044649: 70.0 %
20010827 044845: 80.0 %
20010827 045041: 90.0 %
20010827 045236: 100.0 %
20010827 045236: Sequence 11 completed:
DGPSEJGAQGGHEMYLVNPSDSDVAYMKKGSRGGYVKRPYVKELSGGSGQ KLVWFKATFEV

Originally posted by MikeTimbers


??? My D900 takes 19 minutes to do a 68 ??? WTF, over?

[MikeTimbers]

That's still way faster than mine. What Motherboard/RAM etc?

I'm using an ECS K7S5a with DDR. Supposed to be really quick but it looks like your 650 is beating my 800 running at 900.

[Yo_Mama]

It's a Gigabyte GA-7IXE4. Terrible for oc'ing (can't), but stable as hell. I got it because it was the cheapest Socket A at the time ;)

[MikeTimbers]

Well, not to be out-done by a 650 I pencilled my voltage bridges to raise the default to 1.8v and upped my FSB to 124 so my 800 is now a 992 doing a 68 in 17mins per sequence.

You sure yours ain't clocked?